Host taxon 9606
Protein NP_003082.1
small nuclear ribonucleoprotein-associated proteins B and B' isoform B
Homo sapiens
Gene SNRPB, UniProt P14678
>NP_003082.1|Haemophilus ducreyi 35000HP|small nuclear ribonucleoprotein-associated proteins B and B' isoform B
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.4 | 1.39939380019439 | 5.7e-6 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)