Host taxon 9606
Protein NP_003086.1
small nuclear ribonucleoprotein F
Homo sapiens
Gene SNRPF, UniProt P62306
>NP_003086.1|Haemophilus ducreyi 35000HP|small nuclear ribonucleoprotein F
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.96 | 0.958187490539855 | 0.00078 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)