Host taxon 9606
Protein NP_116565.3
small integral membrane protein 3
Homo sapiens
Gene SMIM3, UniProt Q9BZL3
>NP_116565.3|Haemophilus ducreyi 35000HP|small integral membrane protein 3
MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.54 | 1.53509203828786 | 9.5e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)