Host taxon 9606
Protein NP_001138904.1
small integral membrane protein 20
Homo sapiens
Gene SMIM20, UniProt Q8N5G0
>NP_001138904.1|Haemophilus ducreyi 35000HP|small integral membrane protein 20
MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.8 | 0.798928962024763 | 0.0014 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)