Host taxon 9606
Protein NP_001129047.1
small integral membrane protein 13
Homo sapiens
Gene SMIM13, UniProt P0DJ93
>NP_001129047.1|Haemophilus ducreyi 35000HP|small integral membrane protein 13
MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.31 | -0.307053745643822 | 0.0052 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)