Host taxon 9606
Protein NP_001018118.1
small EDRK-rich factor 2 isoform c
Homo sapiens
Gene SERF2, UniProt P84101
>NP_001018118.1|Haemophilus ducreyi 35000HP|small EDRK-rich factor 2 isoform c
MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.67 | 1.67338768042077 | 4.2e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)