Host taxon 9606
Protein NP_001013720.2
single-pass membrane and coiled-coil domain-containing protein 3
Homo sapiens
Gene SMCO3, UniProt A2RU48
>NP_001013720.2|Haemophilus ducreyi 35000HP|single-pass membrane and coiled-coil domain-containing protein 3
MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.98 | -0.977846507924267 | 0.0066 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)