Host taxon 9606
Protein NP_054760.4
signal peptidase complex subunit 1
Homo sapiens
Gene SPCS1, UniProt Q9Y6A9
>NP_054760.4|Haemophilus ducreyi 35000HP|signal peptidase complex subunit 1
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.97 | 0.96564081087666 | 0.00018 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)