Host taxon 9606
Protein NP_001012526.2
shadow of prion protein precursor
Homo sapiens
Gene SPRN, UniProt Q5BIV9
>NP_001012526.2|Haemophilus ducreyi 35000HP|shadow of prion protein precursor
MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAGAAAGAAAGAAAGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLGGALGALGLLRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.8 | -0.796583213154914 | 0.0049 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)