Host taxon 9606
Protein NP_112576.1
SH3 domain-binding glutamic acid-rich-like protein 3
Homo sapiens
Gene SH3BGRL3, UniProt Q9H299
>NP_112576.1|Haemophilus ducreyi 35000HP|SH3 domain-binding glutamic acid-rich-like protein 3
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.74 | 1.73774687349932 | 2.2e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)