Host taxon 9606
Protein NP_113657.1
SH3 domain-binding glutamic acid-rich-like protein 2
Homo sapiens
Gene SH3BGRL2, UniProt Q9UJC5
>NP_113657.1|Haemophilus ducreyi 35000HP|SH3 domain-binding glutamic acid-rich-like protein 2
MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.3 | -1.29943577571984 | 0.0065 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)