Host taxon 9606
Protein NP_444512.2
SH2 domain-containing protein 1B
Homo sapiens
Gene SH2D1B, UniProt O14796
>NP_444512.2|Haemophilus ducreyi 35000HP|SH2 domain-containing protein 1B
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.42 | 2.41988387868283 | 3.5e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)