Host taxon 9606
Protein NP_001108409.1
SH2 domain-containing protein 1A isoform 2
Homo sapiens
Gene SH2D1A, UniProt O60880
>NP_001108409.1|Haemophilus ducreyi 35000HP|SH2 domain-containing protein 1A isoform 2
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGIREDPDVCLKAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.73 | 2.72566251743826 | 4.7e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)