Host taxon 9606
Protein NP_006503.2
serum amyloid A-4 protein precursor
Homo sapiens
Gene SAA4, UniProt P35542
>NP_006503.2|Haemophilus ducreyi 35000HP|serum amyloid A-4 protein precursor
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.54 | 2.54115982350879 | 0.015 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)