Host taxon 9606
Protein NP_002706.1
serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform isoform 1
Homo sapiens
Gene PPP2CA, UniProt P67775
>NP_002706.1|Haemophilus ducreyi 35000HP|serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform isoform 1
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.42 | 0.42360412643519 | 0.034 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)