Host taxon 9606
Protein NP_003760.1
serine/arginine-rich splicing factor 9
Homo sapiens
Gene SRSF9, UniProt Q13242
>NP_003760.1|Haemophilus ducreyi 35000HP|serine/arginine-rich splicing factor 9
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.75 | 0.750099208967389 | 2.0e-5 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)