Host taxon 9606
Protein NP_001026854.1
serine/arginine-rich splicing factor 7 isoform 1
Homo sapiens
Gene SRSF7, UniProt Q16629
>NP_001026854.1|Haemophilus ducreyi 35000HP|serine/arginine-rich splicing factor 7 isoform 1
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.83 | 0.8284598079558 | 0.00086 | 31213562 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)