Host taxon 9606
Protein NP_001182356.1
serine/arginine-rich splicing factor 2
Homo sapiens
Gene SRSF2, UniProt Q01130
>NP_001182356.1|Haemophilus ducreyi 35000HP|serine/arginine-rich splicing factor 2
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.73 | 0.726400464916347 | 2.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)