Host taxon 9606
Protein NP_542781.3
serine/arginine-rich splicing factor 12 isoform a
Homo sapiens
Gene SRSF12, UniProt Q8WXF0
>NP_542781.3|Haemophilus ducreyi 35000HP|serine/arginine-rich splicing factor 12 isoform a
MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2 | 2.00293601430913 | 6.5e-9 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)