Host taxon 9606
Protein NP_003113.2
serine protease inhibitor Kazal-type 1 precursor
Homo sapiens
Gene SPINK1, UniProt P00995
>NP_003113.2|Haemophilus ducreyi 35000HP|serine protease inhibitor Kazal-type 1 precursor
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.51 | -1.50837601126489 | 0.016 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)