Host taxon 9606
Protein NP_001035189.1
serine palmitoyltransferase small subunit B
Homo sapiens
Gene SPTSSB, UniProt Q8NFR3
>NP_001035189.1|Haemophilus ducreyi 35000HP|serine palmitoyltransferase small subunit B
MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.32 | -1.31582164181483 | 0.00046 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)