Host taxon 9606
Protein NP_001307982.1
serglycin isoform 1 precursor
Homo sapiens
Gene SRGN, UniProt P10124
>NP_001307982.1|Haemophilus ducreyi 35000HP|serglycin isoform 1 precursor
MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.07 | 5.06742715936195 | 2.5e-23 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)