Host taxon 9606
Protein NP_060915.2
selenoprotein S isoform 1
Homo sapiens
Gene SELENOS, UniProt Q9BQE4
>NP_060915.2|Haemophilus ducreyi 35000HP|selenoprotein S isoform 1
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.91 | 0.905053466002677 | 0.0011 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)