Host taxon 9606
Protein NP_067060.2
selenoprotein K
Homo sapiens
Gene SELENOK, UniProt Q9Y6D0
>NP_067060.2|Haemophilus ducreyi 35000HP|selenoprotein K
MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.05 | 1.05452880106785 | 0.00052 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)