Host taxon 9606
Protein NP_004252.2
selenoprotein F isoform 1 precursor
Homo sapiens
Gene SELENOF, UniProt O60613
>NP_004252.2|Haemophilus ducreyi 35000HP|selenoprotein F isoform 1 precursor
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.15 | 1.1522569067353 | 1.7e-9 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)