Host taxon 9606
Protein NP_473364.1
secretoglobin family 3A member 2 precursor
Homo sapiens
Gene SCGB3A2, UniProt Q96PL1
>NP_473364.1|Haemophilus ducreyi 35000HP|secretoglobin family 3A member 2 precursor
MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.09 | -3.08781426608331 | 1.1e-10 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)