Host taxon 9606
Protein NP_001020762.1
secretoglobin family 2B member 2 precursor
Homo sapiens
Gene SCGB2B2, UniProt Q4G0G5
>NP_001020762.1|Haemophilus ducreyi 35000HP|secretoglobin family 2B member 2 precursor
MRVTSATCALLLALICSVQLGDACLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANVSVTERFAHSVVIKKILQSNDCIEAAF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.85 | -0.84557982871663 | 0.0094 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)