Host taxon 9606
Protein NP_803253.1
secreted Ly-6/uPAR domain-containing protein 2 isoform 1 precursor
Homo sapiens
Gene SLURP2, UniProt P0DP57
>NP_803253.1|Haemophilus ducreyi 35000HP|secreted Ly-6/uPAR domain-containing protein 2 isoform 1 precursor
MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.58 | 1.57984098468237 | 0.0038 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)