Host taxon 9606
Protein NP_001129295.1
sarcospan isoform 2
Homo sapiens
Gene SSPN, UniProt Q14714
>NP_001129295.1|Haemophilus ducreyi 35000HP|sarcospan isoform 2
MLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.86 | -0.860750956338556 | 2.3e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)