Host taxon 9606
Protein NP_054907.1
RNA polymerase II subunit A C-terminal domain phosphatase SSU72
Homo sapiens
Gene SSU72, UniProt Q9NP77
>NP_054907.1|Haemophilus ducreyi 35000HP|RNA polymerase II subunit A C-terminal domain phosphatase SSU72
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.71 | 0.712509073590657 | 0.017 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)