Host taxon 9606
Protein NP_079063.2
RING finger protein 122
Homo sapiens
Gene RNF122, UniProt Q9H9V4
>NP_079063.2|Haemophilus ducreyi 35000HP|RING finger protein 122
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.48 | 1.48017637078029 | 5.7e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)