Host taxon 9606
Protein NP_001093140.1
ribosomal biogenesis factor isoform 1
Homo sapiens
Gene RBIS, UniProt Q8N0T1
>NP_001093140.1|Haemophilus ducreyi 35000HP|ribosomal biogenesis factor isoform 1
MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.91 | 0.913081016592149 | 0.00029 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)