Host taxon 9606
Protein NP_001257357.1
rhombotin-1 isoform b
Homo sapiens
Gene LMO1, UniProt P25800
>NP_001257357.1|Haemophilus ducreyi 35000HP|rhombotin-1 isoform b
MVLDQEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.14 | -1.13653752581027 | 0.041 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)