Host taxon 9606
Protein NP_001656.2
rho-related GTP-binding protein RhoG precursor
Homo sapiens
Gene RHOG, UniProt P84095
>NP_001656.2|Haemophilus ducreyi 35000HP|rho-related GTP-binding protein RhoG precursor
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.37 | 2.37019961581097 | 1.4e-10 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)