Host taxon 9606
Protein NP_001071639.1
retrotransposon Gag-like protein 8C
Homo sapiens
Gene RTL8C, UniProt A6ZKI3
>NP_001071639.1|Haemophilus ducreyi 35000HP|retrotransposon Gag-like protein 8C
MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.49 | 0.491224976211445 | 0.01 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)