Host taxon 9606
Protein NP_001306003.2
retina and anterior neural fold homeobox protein 2
Homo sapiens
Gene RAX2, UniProt Q96IS3
>NP_001306003.2|Haemophilus ducreyi 35000HP|retina and anterior neural fold homeobox protein 2
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -1 | -0.995448705596213 | 0.04 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)