Host taxon 9606
Protein NP_002938.1
replication protein A 14 kDa subunit
Homo sapiens
Gene RPA3, UniProt P35244
>NP_002938.1|Haemophilus ducreyi 35000HP|replication protein A 14 kDa subunit
MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.79 | 0.788138109619487 | 0.00048 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)