Host taxon 9606
Protein NP_001182232.1
regulator of G-protein signaling 5 isoform 2
Homo sapiens
Gene RGS5, UniProt O15539
>NP_001182232.1|Haemophilus ducreyi 35000HP|regulator of G-protein signaling 5 isoform 2
MAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.9 | -0.900722527719379 | 0.014 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)