Host taxon 9606
Protein NP_001004312.2
receptor-transporting protein 2
Homo sapiens
Gene RTP2, UniProt Q5QGT7
>NP_001004312.2|Haemophilus ducreyi 35000HP|receptor-transporting protein 2
MCTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPSELAPGWKQYLEQHASGRFHCSWCWHTWQSAHVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYEEDGGQYRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNFLSLRWCLFWASLCLLVVYLQFSFLSPAFF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.52 | 6.51510479963274 | 1.7e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)