Host taxon 9606
Protein NP_001005915.1
receptor tyrosine-protein kinase erbB-3 isoform s precursor
Homo sapiens
Gene ERBB3, UniProt P21860
>NP_001005915.1|Haemophilus ducreyi 35000HP|receptor tyrosine-protein kinase erbB-3 isoform s precursor
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTGQFPMVPSGLTPQPAQDWYLLDDDPRLLTLSASSKVPVTLAAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.52 | -1.51531488846874 | 0.00019 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)