Host taxon 9606
Protein NP_005847.1
receptor activity-modifying protein 3 precursor
Homo sapiens
Gene RAMP3, UniProt O60896
>NP_005847.1|Haemophilus ducreyi 35000HP|receptor activity-modifying protein 3 precursor
METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.84 | 0.840346910290552 | 0.018 | 31213562 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)