Host taxon 9606
Protein NP_542786.1
reactive oxygen species modulator 1
Homo sapiens
Gene ROMO1, UniProt P60602
>NP_542786.1|Haemophilus ducreyi 35000HP|reactive oxygen species modulator 1
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.3 | 1.29563708346172 | 0.0015 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)