Host taxon 9606
Protein NP_001258115.1
ras-related protein Rap-2c isoform 1 precursor
Homo sapiens
Gene RAP2C, UniProt Q9Y3L5
>NP_001258115.1|Haemophilus ducreyi 35000HP|ras-related protein Rap-2c isoform 1 precursor
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.67 | 0.674553218760157 | 0.00072 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)