Host taxon 9606
Protein NP_001258927.1
ras-related protein Rab-4A isoform 2
Homo sapiens
Gene RAB4A, UniProt P20338
>NP_001258927.1|Haemophilus ducreyi 35000HP|ras-related protein Rab-4A isoform 2
MISPDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.39 | -0.38526425718529 | 0.029 | 31213562 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)