Host taxon 9606
Protein NP_001191812.1
ras-related protein Rab-43 isoform a
Homo sapiens
Gene RAB43, UniProt Q86YS6
>NP_001191812.1|Haemophilus ducreyi 35000HP|ras-related protein Rab-43 isoform a
MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.96 | 0.961981054609745 | 0.0028 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)