Host taxon 9606
Protein NP_006393.2
ragulator complex protein LAMTOR5
Homo sapiens
Gene LAMTOR5, UniProt O43504
>NP_006393.2|Haemophilus ducreyi 35000HP|ragulator complex protein LAMTOR5
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.45 | 1.44516248739558 | 1.4e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)