Host taxon 9606
Protein NP_001138736.1
ragulator complex protein LAMTOR2 isoform 2
Homo sapiens
Gene LAMTOR2, UniProt Q9Y2Q5
>NP_001138736.1|Haemophilus ducreyi 35000HP|ragulator complex protein LAMTOR2 isoform 2
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMAQALVQYLEEPLTQVAAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.71 | 1.71250793660529 | 9.1e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)