Host taxon 9606
Protein NP_001239428.1
RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 isoform 1
Homo sapiens
Gene RHNO1, UniProt Q9BSD3
>NP_001239428.1|Haemophilus ducreyi 35000HP|RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 isoform 1
MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.79 | 0.789569159871755 | 0.0076 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)