Host taxon 9606
Protein NP_001243017.1
putative uncharacterized protein C11orf45 isoform 1
Homo sapiens
Gene C11orf45, UniProt Q8TAV5
>NP_001243017.1|Haemophilus ducreyi 35000HP|putative uncharacterized protein C11orf45 isoform 1
MLTRLVLSAHLSSTTSPPWTHAAISWELDNVLMPSPRIWPQVTPTGRSASVRSEGNTSSLWNFSAGQDVHAIVTRTCESVLSSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.05 | -1.04568223947775 | 0.0041 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)