Host taxon 9606
Protein NP_001269086.1
putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform c
Homo sapiens
Gene FTSJ1, UniProt Q9UET6
>NP_001269086.1|Haemophilus ducreyi 35000HP|putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform c
MALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.75 | 0.746664220089186 | 0.00097 | 31213562 | |
Retrieved 1 of 5 entries in 1.5 ms
(Link to these results)